General Information

  • ID:  hor003306
  • Uniprot ID:  P06300
  • Protein name:  Big dynorphin
  • Gene name:  Pdyn
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Opioid neuropeptide precursor family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001515 opioid peptide activity; GO:0005515 protein binding; GO:0031628 opioid receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0007600 sensory perception; GO:0035094 response to nicotine; GO:0035902 response to immobilization stress
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005794 Golgi apparatus; GO:0005886 plasma membrane; GO:0008021 synaptic vesicle; GO:0030425 dendrite; GO:0031045 dense core granule; GO:0043025 neuronal cell body; GO:0043197 dendritic spine; GO:0043679 axon terminus; GO:0098686 hippocampal mossy fiber to CA3 synapse; GO:0098992 neuronal dense core vesicle; GO:0099013 neuronal dense core vesicle lumen

Sequence Information

  • Sequence:  YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
  • Length:  32(202-233)
  • Propeptide:  MAWSRLMLAACLLVIPSEVAADCLSLCSLCAVRTQDGPHPINPLICSLECQDLVPPSEEWETCRGFWSFLTLTASGLHGKDDLENEVALEEGYTALTKLLEPLLKELEKGQLLTSVSEEKLRGLSSRFGNGRESELLGTDLMNDEAAQAGTLHFNEEDLRKQAKRYGGFLRKYPKRSSEMTGDEDRGQDGDQVGHEDLYKRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQENPNTYSEDLDV
  • Signal peptide:  MAWSRLMLAACLLVIPSEVAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Leu-enkephalins compete with and mimic the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Oprk1
  • Target Unid:  P34975
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06300-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003306_AF2.pdbhor003306_ESM.pdb

Physical Information

Mass: 453782 Formula: C185H292N58O41
Absent amino acids: ACEHMS Common amino acids: R
pI: 12.25 Basic residues: 10
Polar residues: 8 Hydrophobic residues: 10
Hydrophobicity: -97.81 Boman Index: -9822
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 66.88
Instability Index: 5977.81 Extinction Coefficient cystines: 8480
Absorbance 280nm: 273.55

Literature

  • PubMed ID:  3858883
  • Title:  Sequence and Expression of the Rat Prodynorphin Gene